Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6C1 (Ly6c1)

Product Specifications

Product Name Alternative

Ly6c1; Lymphocyte antigen 6C1; Ly-6C1

Abbreviation

Recombinant Mouse Ly6c1 protein

Gene Name

Ly6c1

UniProt

P0CW02

Expression Region

27-109aa

Organism

Mus musculus (Mouse)

Target Sequence

LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG

Tag

N-terminal 6xHis-sumostar-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.1 kDa

References & Citations

"B cells express Ly-6C in a Th1 but not Th2 cytokine environment." Schlueter A.J., Krieg A.M., De Vries P., Li X. J. Interferon Cytokine Res. 22:799-806 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO4 Mouse Monoclonal Antibody [Clone ID: OTI10F12]
CF808604 100 µg

FOXO4 Mouse Monoclonal Antibody [Clone ID: OTI10F12]

Sign In for Pricing
View Details
Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF568 conjugate, 0.1mg/mL
BNC681877-100 1x 100 µL

Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENO2 Antibody
KC-6315-01 50 μL

ENO2 Antibody

Sign In for Pricing
View Details
ENO2 Antibody
KC-6315-02 100 µL

ENO2 Antibody

Sign In for Pricing
View Details
ENO2 Antibody
KC-6315-03 1 mL

ENO2 Antibody

Sign In for Pricing
View Details
(R,S)-Nornicotine
TRC-N757000-50MG 50 mg

(R,S)-Nornicotine

Sign In for Pricing
View Details