Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

Product Specifications

Product Name Alternative

18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL (Phe)

Abbreviation

Recombinant Human SFTPB protein

Gene Name

SFTPB

UniProt

P07988

Expression Region

201-279aa

Organism

Homo sapiens (Human)

Target Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Tag

Tag-Free

Type

In Stock Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Molecular Weight

8.7 kDa

References & Citations

"Conformational mapping of the N-terminal segment of surfactant protein B in lipid using 13C-enhanced Fourier transform infrared spectroscopy." Gordon L.M., Lee K.Y., Lipp M.M., Zasadzinski J.A., Walther F.J., Sherman M.A., Waring A.J. J. Pept. Res. 55:330-347 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP12 (FKBP1A) (NM_000801) Human Over-expression Lysate
LC400279 20 µg

FKBP12 (FKBP1A) (NM_000801) Human Over-expression Lysate

Sign In for Pricing
View Details
Nickel(II) Bromide
TRC-N901185-25G 25 g

Nickel(II) Bromide

Sign In for Pricing
View Details
Human THEGL activation kit by CRISPRa
GA119303 1 Kit

Human THEGL activation kit by CRISPRa

Sign In for Pricing
View Details
Vmn1r237 Mouse Gene Knockout Kit (CRISPR)
KN519033 1 Kit

Vmn1r237 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (B2M/961), 0.2mg/mL
BNUB0961-100 1x 100 µL

Beta-2 Microglobulin (B2M) (B2M/961), 0.2mg/mL

Sign In for Pricing
View Details
RUNX1T1 Human Gene Knockout Kit (CRISPR)
KN400898 1 Kit

RUNX1T1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details