Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dihydropyrimidinase-related protein 1 (CRMP1)

Product Specifications

Product Name Alternative

Collapsin response mediator protein 1

Abbreviation

Recombinant Human CRMP1 protein

Gene Name

CRMP1

UniProt

Q14194

Expression Region

1-572aa

Organism

Homo sapiens (Human)

Target Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. May participate in cytokinesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. May participate in cytokinesis.

Molecular Weight

62.2 kDa

References & Citations

"Long form collapsin response mediator protein-1 (LCRMP-1) expression is associated with clinical outcome and lymph node metastasis in non-small cell lung cancer patients." Pan S.-H., Chao Y.-C., Chen H.Y., Hung P.F., Lin P.Y., Lin C.W., Chang Y.L., Wu C.T., Lee Y.C., Yang S.-C., Hong T.-M., Yang P.-C. Lung Cancer 67:93-100 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC eta/PRKCL Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61639R-BF750-01 20 µL

PKC eta/PRKCL Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PKC eta/PRKCL Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61639R-BF750-02 100 µL

PKC eta/PRKCL Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Olr964 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7401802 1.0 µg DNA

Olr964 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
IP6K1 Antibody
A26393-100UG 100 µg

IP6K1 Antibody

Sign In for Pricing
View Details
Biotin-Linked Anti-Neuropilin 2 (NRP2)
FY-AB41415-01 1 mL

Biotin-Linked Anti-Neuropilin 2 (NRP2)

Sign In for Pricing
View Details
Biotin-Linked Anti-Neuropilin 2 (NRP2)
FY-AB41415-02 100 µL

Biotin-Linked Anti-Neuropilin 2 (NRP2)

Sign In for Pricing
View Details