Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Integrin beta-8 (ITGB8), partial

Product Specifications

Product Name Alternative

ITGB8Integrin beta-8

Abbreviation

Recombinant Rabbit ITGB8 protein, partial

Gene Name

ITGB8

UniProt

P26013

Expression Region

146-384aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Integrin alpha-V/beta-8 is a receptor for fibronectin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Integrin alpha-V/beta-8 is a receptor for fibronectin.

Molecular Weight

30.4 kDa

References & Citations

"Cloning and expression of a divergent integrin subunit beta 8." Moyle M., Napier M.A., McLean J.W. J. Biol. Chem. 266:19650-19658 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM4 (Minichromosome Maintenance Deficient 4, CDC21, CDC21 Homolog, CDC54, DNA Replication Licensing Factor MCM4, hCdc21, Homolog of S. pombe Cell Devision Cycle 21, MGC33310, Minichromosome Maintenance 4, Minichromosome Maintenance Complex Component 4, P1-CDC21) (FITC)
129499-FITC 100 µL

MCM4 (Minichromosome Maintenance Deficient 4, CDC21, CDC21 Homolog, CDC54, DNA Replication Licensing Factor MCM4, hCdc21, Homolog of S. pombe Cell Devision Cycle 21, MGC33310, Minichromosome Maintenance 4, Minichromosome Maintenance Complex Component 4, P1-CDC21) (FITC)

Sign In for Pricing
View Details
Anti-Cullin 2/CUL2 Antibody Picoband® Fluoro594 Conjugated
PA1877-Fluoro594 100 µg/Vial

Anti-Cullin 2/CUL2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Biotin-Vitamin B12
HY-B0315A-01 5 mg

Biotin-Vitamin B12

Sign In for Pricing
View Details
Biotin-Vitamin B12
HY-B0315A-02 10 mg

Biotin-Vitamin B12

Sign In for Pricing
View Details
Recombinant Mouse Tripartite motif-containing protein 47 (Trim47)
MBS1280743-01 0.02 mg (E-Coli)

Recombinant Mouse Tripartite motif-containing protein 47 (Trim47)

Sign In for Pricing
View Details
Recombinant Mouse Tripartite motif-containing protein 47 (Trim47)
MBS1280743-02 0.02 mg (Yeast)

Recombinant Mouse Tripartite motif-containing protein 47 (Trim47)

Sign In for Pricing
View Details