Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 2B (SPRR2B)

Product Specifications

Product Name Alternative

SPRR2B; Small proline-rich protein 2B; SPR-2B

Abbreviation

Recombinant Human SPRR2B protein

Gene Name

SPRR2B

UniProt

P35325

Expression Region

1-72aa

Organism

Homo sapiens (Human)

Target Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Molecular Weight

11.5 kDa

References & Citations

"Genetic variation in small proline rich protein 2B as a predictor for asthma among children with eczema." Epstein T.G., LeMasters G.K., Bernstein D.I., Ericksen M.B., Martin L.J., Ryan P.H., Biagini Myers J.M., Butsch Kovacic M.S., Lindsey M.A., He H., Reponen T., Villareal M.S., Lockey J.E., Bernstein C.K., Khurana Hershey G.K. Ann. Allergy Asthma Immunol. 108:145-150 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Benzyloxycarbonyl Nortropine
TRC-B286240-50MG 50 mg

N-Benzyloxycarbonyl Nortropine

Sign In for Pricing
View Details
Draquinolol
TRC-D678915-100MG 100 mg

Draquinolol

Sign In for Pricing
View Details
Tris Hydrochloride (Tris-HCl), 1kg
PR0614-1kg 1 Kg

Tris Hydrochloride (Tris-HCl), 1kg

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), 0.2mg/mL
BNUB2125-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), 0.2mg/mL

Sign In for Pricing
View Details
RUNX3 (NM_001031680) Human Over-expression Lysate
LY400418 100 µg

RUNX3 (NM_001031680) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene AM HMPA
H40045015.100G 100 g

Polystyrene AM HMPA

Sign In for Pricing
View Details