Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Recombination protein RecR (recR)

Product Specifications

Product Name Alternative

RecR; MRA_3752; Recombination protein RecR

Abbreviation

Recombinant Mycobacterium tuberculosis recR protein

Gene Name

RecR

UniProt

A5U941

Expression Region

1-203aa

Organism

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Target Sequence

MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Molecular Weight

26.1 kDa

References & Citations

"Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv." Zheng H., Lu L., Wang B., Pu S., Zhang X., Zhu G., Shi W., Zhang L., Wang H., Wang S., Zhao G., Zhang Y. PLoS ONE 3:E2375-E2375 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdlim7 (NM_026131) Mouse Tagged ORF Clone
MG201778 10 µg

Pdlim7 (NM_026131) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF568 conjugate, 0.1mg/mL
BNC683177-100 1x 100 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ExoBriteTM 515/540 True EV Membrane Stain, 500 labelings
#30129 1x 500 µL

ExoBriteTM 515/540 True EV Membrane Stain, 500 labelings

Sign In for Pricing
View Details
Mouse Cebpa activation kit by CRISPRa
GA200689 1 Kit

Mouse Cebpa activation kit by CRISPRa

Sign In for Pricing
View Details
ELOA2 Antibody
8C13048-AAT 50 µg

ELOA2 Antibody

Sign In for Pricing
View Details
FBXL13 antibody
FNab03032 100 µg

FBXL13 antibody

Sign In for Pricing
View Details