Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial

Product Specifications

Product Name Alternative

Nucleocapsid protein

Abbreviation

Recombinant Zaire ebolavirus NP protein, partial

Gene Name

NP

UniProt

P18272

Expression Region

488-739aa

Organism

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Target Sequence

LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.1 kDa

References & Citations

"The assembly of Ebola virus nucleocapsid requires virion-associated proteins 35 and 24 and posttranslational modification of nucleoprotein." Huang Y., Xu L., Sun Y., Nabel G.J. Mol. Cell 10:307-316 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLIN2 Polyclonal Antibody
E-AB-13074-01 20 µL

PLIN2 Polyclonal Antibody

Sign In for Pricing
View Details
PLIN2 Polyclonal Antibody
E-AB-13074-02 60 µL

PLIN2 Polyclonal Antibody

Sign In for Pricing
View Details
PLIN2 Polyclonal Antibody
E-AB-13074-03 120 µL

PLIN2 Polyclonal Antibody

Sign In for Pricing
View Details
PLIN2 Polyclonal Antibody
E-AB-13074-04 200 µL

PLIN2 Polyclonal Antibody

Sign In for Pricing
View Details
RHOC (NM_175744) Human Over-expression Lysate
LC403579 20 µg

RHOC (NM_175744) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS621467 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details