Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2)

Product Specifications

Product Name Alternative

Hydrophobin II

Abbreviation

Recombinant Hypocrea jecorina hfb2 protein

Gene Name

Hfb2

UniProt

P79073

Expression Region

16-86aa

Organism

Hypocrea jecorina (Trichoderma reesei)

Target Sequence

AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Responsible for spore hydrophobicity and protection.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Responsible for spore hydrophobicity and protection.

Molecular Weight

10.7 kDa

References & Citations

"Differential expression of the vegetative and spore-bound hydrophobins of Trichoderma reesei: cloning and characterization of the hfb2 gene." Nakari-Setaelae T., Aro N., Ilmen M., Munoz G., Kalkkinen N., Penttilae M. Eur. J. Biochem. 248:415-423 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Pancreas
CS708540 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
DNAJC14 (NM_032364) Human Recombinant Protein
TP322220M 100 µg

DNAJC14 (NM_032364) Human Recombinant Protein

Sign In for Pricing
View Details
RTL1 (C-term) Rabbit Polyclonal Antibody
AP53764PU-N 400 µL

RTL1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AZD 9291 (Osimertinib)
TRC-A808075-5MG 5 mg

AZD 9291 (Osimertinib)

Sign In for Pricing
View Details
Mix-n-StainTM Cyanine 555 Antibody Labeling Kit, 1x (5-20ug) labeling
#92412 1 Kit

Mix-n-StainTM Cyanine 555 Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
NT5C1A (NM_032526) Human Recombinant Protein
TP324617 20 µg

NT5C1A (NM_032526) Human Recombinant Protein

Sign In for Pricing
View Details