Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2)

Product Specifications

Product Name Alternative

Hydrophobin II

Abbreviation

Recombinant Hypocrea jecorina hfb2 protein

Gene Name

Hfb2

UniProt

P79073

Expression Region

16-86aa

Organism

Hypocrea jecorina (Trichoderma reesei)

Target Sequence

AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Responsible for spore hydrophobicity and protection.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Responsible for spore hydrophobicity and protection.

Molecular Weight

10.7 kDa

References & Citations

"Differential expression of the vegetative and spore-bound hydrophobins of Trichoderma reesei: cloning and characterization of the hfb2 gene." Nakari-Setaelae T., Aro N., Ilmen M., Munoz G., Kalkkinen N., Penttilae M. Eur. J. Biochem. 248:415-423 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF405S conjugate, 0.1mg/mL
BNC042983-100 1x 100 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Rat IgG (min.x Hu., Bov., Eq.),
AAF-462-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Rat IgG (min.x Hu., Bov., Eq.),

Sign In for Pricing
View Details
AMBP Antibody
KC-172-01 50 μL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-172-02 100 µL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-172-03 1 mL

AMBP Antibody

Sign In for Pricing
View Details
TWIST2 (NM_057179) Human Recombinant Protein
TP305006L 1 mg

TWIST2 (NM_057179) Human Recombinant Protein

Sign In for Pricing
View Details