Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis F1 capsule antigen (caf1)

Product Specifications

Product Name Alternative

Caf1; YPMT1.84; Y1100; YP_pMT082F1 capsule antigen

Abbreviation

Recombinant Yersinia pestis caf1 protein

Gene Name

Caf1

UniProt

P26948

Expression Region

22-170aa

Organism

Yersinia pestis

Target Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.6 kDa

References & Citations

"Nucleotide sequence of the Yersinia pestis gene encoding F1 antigen and the primary structure of the protein. Putative T and B cell epitopes." Galyov E.E., Smirnov O.Y., Karlishev A.V., Volkovoy K.I., Denesyuk A.I., Nazimov I.V., Rubtsov K.S., Abramov V.M., Dalvadyanz S.M., Zav'Yalov V.P. FEBS Lett. 277:230-232 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SENP5 shRNA (UAS) - Lentiviral human SENP5 shRNA (UAS) plasmid
GTR15080767 1 Vial

Lentiviral human SENP5 shRNA (UAS) - Lentiviral human SENP5 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)
MBS2121570-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)
MBS2121570-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)
MBS2121570-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)
MBS2121570-04 1 mL

Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)
MBS2121570-05 5 mL

Cy3-Linked Monoclonal Antibody to Laminin Alpha 3 (LAMa3)

Sign In for Pricing
View Details