Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22 (rplV)

Product Specifications

Product Name Alternative

RplV; APH_0285; 50S ribosomal protein L22

Abbreviation

Recombinant Anaplasma phagocytophilum rplV protein

Gene Name

RplV

UniProt

Q2GL54

Expression Region

1-112aa

Organism

Anaplasma phagocytophilum (strain HZ)

Target Sequence

MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER

Tag

N-terminal 10xHis-tagged and C-terminal MYC-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome.UniRule annotation The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity) .

Molecular Weight

17.2 kDa

References & Citations

"Comparative genomics of emerging human ehrlichiosis agents." Dunning Hotopp J.C., Lin M., Madupu R., Crabtree J., Angiuoli S.V., Eisen J.A., Seshadri R., Ren Q., Wu M., Utterback T.R., Smith S., Lewis M., Khouri H., Zhang C., Niu H., Lin Q., Ohashi N., Zhi N. Tettelin H. PLoS Genet. 2:208-222 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit
MBS2704244-01 24 Strip Well

Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit

Sign In for Pricing
View Details
Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit
MBS2704244-02 48 Well

Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit

Sign In for Pricing
View Details
Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit
MBS2704244-03 96 Well

Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit

Sign In for Pricing
View Details
Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit
MBS2704244-04 5x 96 Well

Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit

Sign In for Pricing
View Details
Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit
MBS2704244-05 10x 96 Well

Human Major Histocompatibility Complex Class II DR Beta 1 (MHCDRb1) ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-4735-5p miRNA Agomir
CMJ1593-01 5 nmol

Hsa-miR-4735-5p miRNA Agomir

Sign In for Pricing
View Details