Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis Subtilisin Carlsberg (subC)

Product Specifications

Product Name Alternative

SubC; apr; Subtilisin Carlsberg; EC 3.4.21.62

Abbreviation

Recombinant Bacillus licheniformis subC protein

Gene Name

Apr

UniProt

P00780

Expression Region

106-379aa

Organism

Bacillus licheniformis

Target Sequence

AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ

Tag

N-terminal 10xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.

Molecular Weight

42.0 kDa

References & Citations

"Subtilisin Carlsberg. V. The complete sequence; comparison with subtilisin BPN'; evolutionary relationships." Smith E.L., Delange R.J., Evans W.H., Landon M., Markland F.S. J. Biol. Chem. 243:2184-2191 (1968)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
PI3-kinase p110 subunit beta Recombinant Rabbit Monoclonal Antibody [SC0580]
ET1610-36 100 µL

PI3-kinase p110 subunit beta Recombinant Rabbit Monoclonal Antibody [SC0580]

Sign In for Pricing
View Details
CD20 Recombinant Chimeric Antibody Antibody
HA610360 100 µL

CD20 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS622831 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
GUCY1B1 (189-207) Rabbit Polyclonal Antibody
AP22710PU-N 250 µL

GUCY1B1 (189-207) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details