Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Apolipoprotein E (APOE), partial

Product Specifications

Product Name Alternative

APOEApolipoprotein E; Apo-E

Abbreviation

Recombinant Rabbit APOE protein, partial

Gene Name

APOE

UniProt

P18287

Expression Region

20-311aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Tag

N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.

Molecular Weight

50.6 kDa

References & Citations

"Isolation and characterization of a full-length rabbit apolipoprotein E cDNA." Hao Q.L., Yamin T.T., Pan T.C., Chen S.L., Chen B.S., Kroon P.A., Chao Y.S. Atherosclerosis 66:125-130 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT15 Rabbit Polyclonal Antibody (HRP)
orb2114243 100 µL

NAT15 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human Adiponectin/Acrp30 MAb (Clone 553530R)
MAB10654-SP 25 µg

Human Adiponectin/Acrp30 MAb (Clone 553530R)

Sign In for Pricing
View Details
EGFR antibody
MBS200207-01 0.05 mL

EGFR antibody

Sign In for Pricing
View Details
EGFR antibody
MBS200207-02 0.1 mL

EGFR antibody

Sign In for Pricing
View Details
EGFR antibody
MBS200207-03 5x 0.05 mL

EGFR antibody

Sign In for Pricing
View Details
EGFR antibody
MBS200207-04 5x 0.1 mL

EGFR antibody

Sign In for Pricing
View Details