What sizes are available for Recombinant Human Prolactin-inducible protein (PIP)?

Recombinant Human Prolactin-inducible protein (PIP) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Prolactin-inducible protein (PIP) come in?

Recombinant Human Prolactin-inducible protein (PIP) is available in 3 different pack sizes.

Who manufactures Recombinant Human Prolactin-inducible protein (PIP)?

Recombinant Human Prolactin-inducible protein (PIP) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Prolactin-inducible protein (PIP)?

Estimated delivery time for Recombinant Human Prolactin-inducible protein (PIP) is approximately 15 business day(s), depending on your location.

Recombinant Human Prolactin-inducible protein (PIP)

Q: What is the catalog number for Recombinant Human Prolactin-inducible protein (PIP)?

The catalog number for Recombinant Human Prolactin-inducible protein (PIP) is CSB-YP018020HU.

Q: Is Recombinant Human Prolactin-inducible protein (PIP) in stock?

Recombinant Human Prolactin-inducible protein (PIP) is currently made to order / not held in immediate stock. Contact us for lead time.

Product Specifications

Product Name Alternative

Gross cystic disease fluid protein 15

Abbreviation

Recombinant Human PIP protein

Gene Name

PIP

UniProt

P12273

Expression Region

29-146aa

Organism

Homo sapiens (Human)

Target Sequence

QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16 kDa

References & Citations

"The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation." Myal Y., Iwasiow B., Tsuyuki D., Wong P., Shiu R.P.C. Mol. Cell. Endocrinol. 80:165-175 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.