Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prolactin-inducible protein (PIP)

Product Specifications

Product Name Alternative

Gross cystic disease fluid protein 15

Abbreviation

Recombinant Human PIP protein

Gene Name

PIP

UniProt

P12273

Expression Region

29-146aa

Organism

Homo sapiens (Human)

Target Sequence

QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16 kDa

References & Citations

"The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation." Myal Y., Iwasiow B., Tsuyuki D., Wong P., Shiu R.P.C. Mol. Cell. Endocrinol. 80:165-175 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAALAD2 (NM_001300930) Human Tagged ORF Clone
RC239374 10 µg

NAALAD2 (NM_001300930) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal TLR4 Antibody [mFluor Violet 610 SE]
NBP2-24538MFV610 0.1 mL

Rabbit Polyclonal TLR4 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
TRV-0041392-01 20 µL

Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
TRV-0041392-02 100 µL

Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
TRV-0041392-03 200 µL

Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
TRV-0041392-04 1 mL

Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Sign In for Pricing
View Details