Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prolactin-inducible protein (PIP)

Product Specifications

Product Name Alternative

Gross cystic disease fluid protein 15

Abbreviation

Recombinant Human PIP protein

Gene Name

PIP

UniProt

P12273

Expression Region

29-146aa

Organism

Homo sapiens (Human)

Target Sequence

QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16 kDa

References & Citations

"The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation." Myal Y., Iwasiow B., Tsuyuki D., Wong P., Shiu R.P.C. Mol. Cell. Endocrinol. 80:165-175 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC391322 (NM_001144931) Human Tagged ORF Clone
RC226866 10 µg

LOC391322 (NM_001144931) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ppm1h (NM_001110218) Mouse Tagged ORF Clone
MG218309 10 µg

Ppm1h (NM_001110218) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PTGS1 antibody
70R-19627 50 ul

PTGS1 antibody

Sign In for Pricing
View Details
Human CD20/MS4A1 Antibody , FITC
E55A07225 50 Tests

Human CD20/MS4A1 Antibody , FITC

Sign In for Pricing
View Details
PITRM1 Antibody
CST 24770S 100 µL

PITRM1 Antibody

Sign In for Pricing
View Details
Zbtb39 Mouse shRNA Plasmid (Locus ID 320080)
TL508288 1 Kit

Zbtb39 Mouse shRNA Plasmid (Locus ID 320080)

Sign In for Pricing
View Details