Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avena sativa Endochitinase, partial

Product Specifications

Product Name Alternative

Endochitinase; EC 3.2.1.14; Fragments

Abbreviation

Recombinant Avena sativa Endochitinase protein, partial

UniProt

P86181

Expression Region

1-200aa

Organism

Avena sativa (Oat)

Target Sequence

VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

This protein functions as a defense against chitin-containing fungal pathogens

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This protein functions as a defense against chitin-containing fungal pathogens.

Molecular Weight

25.2 kDa

References & Citations

"Oat (Avena sativa) seed extract as an antifungal food preservative through the catalytic activity of a highly abundant class I chitinase." Sorensen H.P., Madsen L.S., Petersen J., Andersen J.T., Hansen A.M., Beck H.C. Appl. Biochem. Biotechnol. 160:1573-1584 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein
TP313083 20 µg

p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein

Sign In for Pricing
View Details
GBE1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D11]
TA500829AM 100 µL

GBE1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D11]

Sign In for Pricing
View Details
Streptavidin Mouse Monoclonal Antibody [Clone ID: 36G3]
AM20223PU-N 100 µg

Streptavidin Mouse Monoclonal Antibody [Clone ID: 36G3]

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), Biotin conjugate, 0.1mg/mL
BNCB1953-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Bromo-4-chloro-3-indolyl b-D-Galactopyranoside
TRC-B682350-1G 1 g

5-Bromo-4-chloro-3-indolyl b-D-Galactopyranoside

Sign In for Pricing
View Details
Granulocyte Marker (BM-2), CF647 conjugate, 0.1mg/mL
BNC470062-100 1x 100 µL

Granulocyte Marker (BM-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details