Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6E (Ly6e)

Product Specifications

Product Name Alternative

Stem cell antigen 2 Thymic shared antigen 1

Abbreviation

Recombinant Mouse Ly6e protein

Gene Name

Ly6e

UniProt

Q64253

Expression Region

27-108aa

Organism

Mus musculus (Mouse)

Target Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Involved in T-cell development.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in T-cell development

Molecular Weight

13.8 kDa

References & Citations

"Genomic organization and expression of mouse thymic shared antigen-1 (TSA-1) : evidence for a processed pseudogene." Classon B.J., Coverdale L. Immunogenetics 44:222-226 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMRT1 Rabbit Polyclonal Antibody (Fluoro488)
orb3074364 100 µg

DMRT1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)
MBS1399346-01 0.02 mg (E-Coli)

Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)

Sign In for Pricing
View Details
Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)
MBS1399346-02 0.1 mg (E-Coli)

Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)

Sign In for Pricing
View Details
Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)
MBS1399346-03 0.02 mg (Yeast)

Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)

Sign In for Pricing
View Details
Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)
MBS1399346-04 0.1 mg (Yeast)

Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)

Sign In for Pricing
View Details
Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)
MBS1399346-05 0.02 mg (Baculovirus)

Recombinant Haemophilus somnus Putative Holliday junction resolvase (HS_0010)

Sign In for Pricing
View Details