Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathelicidin antimicrobial peptide (CAMP)

Product Specifications

Product Name Alternative

18KDA cationic antimicrobial protein

Abbreviation

Recombinant Human CAMP protein

Gene Name

CAMP

UniProt

P49913

Expression Region

132-170aa

Organism

Homo sapiens (Human)

Target Sequence

FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Molecular Weight

24.7 kDa

References & Citations

"FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis." Agerberth B., Gunne H., Odeberg J., Kogner P., Boman H.G., Gudmundsson G.H. Proc. Natl. Acad. Sci. U.S.A. 92:195-199 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IFN beta Recombinant Rabbit monoclonal Antibody
HA722605B 100 µL

Mouse IFN beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CF®488A-Dextran 40,000 MW, Anionic and Fixable
#80126 1x 1 mg

CF®488A-Dextran 40,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
CoREST (RCOR1) Rabbit Polyclonal Antibody
TA372266 100 µL

CoREST (RCOR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ceramide synthase 2 (CERS2) Human Gene Knockout Kit (CRISPR)
KN200145RB 1 Kit

Ceramide synthase 2 (CERS2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KLHL29 (NM_052920) Human Recombinant Protein
TP328604L 1 mg

KLHL29 (NM_052920) Human Recombinant Protein

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details