Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C1orf54 (C1orf54)

Product Specifications

Product Name Alternative

C1orf54Uncharacterized protein C1orf54

Abbreviation

Recombinant Human C1orf54 protein

Gene Name

C1orf54

UniProt

Q8WWF1

Expression Region

17-131aa

Organism

Homo sapiens (Human)

Target Sequence

QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.2 kDa

References & Citations

"The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016UC-01 25 µg

FITC Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details
FITC Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016UC-02 100 µg

FITC Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL
BNC400950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VISTA / B7-H5 / VSIR (Negative Regulator of Immune Response) (VISTA/3007), CF568 conjugate, 0.1mg/mL
BNC683007-500 1x 500 µL

VISTA / B7-H5 / VSIR (Negative Regulator of Immune Response) (VISTA/3007), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF594 conjugate, 0.1mg/mL
BNC941574-100 1x 100 µL

HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Cadherin 22 (CDH22) activation kit by CRISPRa
GA112062 1 Kit

Human Cadherin 22 (CDH22) activation kit by CRISPRa

Sign In for Pricing
View Details