Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C1orf54 (C1orf54)

Product Specifications

Product Name Alternative

C1orf54Uncharacterized protein C1orf54

Abbreviation

Recombinant Human C1orf54 protein

Gene Name

C1orf54

UniProt

Q8WWF1

Expression Region

17-131aa

Organism

Homo sapiens (Human)

Target Sequence

QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.2 kDa

References & Citations

"The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit
RDR-VEGFA-Rb-01 96 Tests

Rabbit Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit
RDR-VEGFA-Rb-02 48 Tests

Rabbit Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit

Sign In for Pricing
View Details
BTD (372-385) Goat Polyclonal Antibody
AP32132PU-N 100 µg

BTD (372-385) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505972 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
PAK1 Rabbit Polyclonal Antibody
AP02681PU-S 50 µL

PAK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NOB1 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
CF808793 100 µg

NOB1 Mouse Monoclonal Antibody [Clone ID: OTI1C12]

Sign In for Pricing
View Details