Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA)

Product Specifications

Product Name Alternative

2-ketoacid reductase

Abbreviation

Recombinant E.coli ghrA protein

Gene Name

GhrA

UniProt

B7LFE3

Expression Region

1-312aa

Organism

Escherichia coli (strain 55989 / EAEC)

Target Sequence

MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.

Molecular Weight

35.4 kDa

References & Citations

"Organised genome dynamics in the Escherichia coli species results in highly diverse adaptive paths." Touchon M., Hoede C., Tenaillon O., Barbe V., Baeriswyl S., Bidet P., Bingen E., Bonacorsi S., Bouchier C., Bouvet O., Calteau A., Chiapello H., Clermont O., Cruveiller S., Danchin A., Diard M., Dossat C., Karoui M.E.Denamur E. PLoS Genet. 5:E1000344-E1000344 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKLN1 Protein Vector (Human) (pPB-C-His)
PV100402 500 ng

MKLN1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (PE)
128575-PE 100 µL

IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (PE)

Sign In for Pricing
View Details
TH1L CRISPRa sgRNA lentivector (set of three targets)(Human)
46623121 3x 1.0µg DNA

TH1L CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
-beta-Alanine amide hydrochloride
260639-01 2 g

-beta-Alanine amide hydrochloride

Sign In for Pricing
View Details
-beta-Alanine amide hydrochloride
260639-02 5 g

-beta-Alanine amide hydrochloride

Sign In for Pricing
View Details
-beta-Alanine amide hydrochloride
260639-03 10 g

-beta-Alanine amide hydrochloride

Sign In for Pricing
View Details