Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azotobacter vinelandii Alginate lyase (algL)

Product Specifications

Product Name Alternative

Poly (beta-D-mannuronate) lyase

Abbreviation

Recombinant Azotobacter vinelandii algL protein

Gene Name

AlgL

UniProt

O52195

Expression Region

24-374aa

Organism

Azotobacter vinelandii

Target Sequence

AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues. May serve to degrade mislocalized alginate that is trapped in the periplasmic space

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues

Molecular Weight

59 kDa

References & Citations

"Biochemical properties and substrate specificities of a recombinantly produced Azotobacter vinelandii alginate lyase." Ertesvag H., Erlien F., Skjak-Braek G., Rehm B.H., Valla S. J. Bacteriol. 180:3779-3784 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tpmt ORF Vector (Rat) (pORF)
ORF078141 1.0 µg DNA

Tpmt ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Olfr342 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4225602 1.0 µg DNA

Olfr342 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rat Tcr Alpha/Beta (low endotoxin) Antibody
GWB-51A69B 0.5 mg

Rat Tcr Alpha/Beta (low endotoxin) Antibody

Sign In for Pricing
View Details
dTMP Kinase Polyclonal Antibody
UB-GEN-3744 100 µL

dTMP Kinase Polyclonal Antibody

Sign In for Pricing
View Details
Pomt1 Mouse shRNA Plasmid (Locus ID 99011)
TL515135 1 Kit

Pomt1 Mouse shRNA Plasmid (Locus ID 99011)

Sign In for Pricing
View Details
LGI1 Rabbit mAb
MBS4763640-01 0.1 mL

LGI1 Rabbit mAb

Sign In for Pricing
View Details