Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dahlia merckii Defensin-like protein 1

Product Specifications

Product Name Alternative

Cysteine-rich antimicrobial protein 1 Defensin AMP1

Abbreviation

Recombinant Dahlia merckii Defensin-like protein 1 protein

UniProt

P0C8Y4

Expression Region

1-50aa

Organism

Dahlia merckii (Bedding dahlia)

Target Sequence

ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

Tag

N-terminal 6xHis-B2M-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca (2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Molecular Weight

19.5 kDa

References & Citations

"Fungal membrane responses induced by plant defensins and thionins." Thevissen K., Ghazi A., De Samblanx G.W., Brownlee C., Osborn R.W., Broekaert W.F. J. Biol. Chem. 271:15018-15025 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-500 1x 500 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-500 1x 500 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF647 conjugate, 0.1mg/mL
BNC472341-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details