Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8)

Product Specifications

Product Name Alternative

CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 CD_antigen: CD66b

Abbreviation

Recombinant Human CEACAM8 protein

Gene Name

CEACAM8

UniProt

P31997

Expression Region

35-320aa

Organism

Homo sapiens (Human)

Target Sequence

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.5 kDa

References & Citations

"High expression of CEACAM6 and CEACAM8 mRNA in acute lymphoblastic leukemias." Lasa A., Serrano E., Carricondo M., Carnicer M.J., Brunet S., Badell I., Sierra J., Aventin A., Nomdedeu J.F. Ann. Hematol. 87:205-211 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Testoterone,T ELISA Kit
CN-03934H1 96T

Human Testoterone,T ELISA Kit

Sign In for Pricing
View Details
Galnon TFA
BUP09399-01 5 mg

Galnon TFA

Sign In for Pricing
View Details
Galnon TFA
BUP09399-02 10 mg

Galnon TFA

Sign In for Pricing
View Details
Galnon TFA
BUP09399-03 25 mg

Galnon TFA

Sign In for Pricing
View Details
Galnon TFA
BUP09399-04 50 mg

Galnon TFA

Sign In for Pricing
View Details
Galnon TFA
BUP09399-05 100 mg

Galnon TFA

Sign In for Pricing
View Details