Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), partial

Product Specifications

Product Name Alternative

Carcinoembryonic antigen CGM1 CD_antigen: CD66d

Abbreviation

Recombinant Human CEACAM3 protein, partial

Gene Name

CEACAM3

UniProt

P40198

Expression Region

35-155aa

Organism

Homo sapiens (Human)

Target Sequence

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.

Molecular Weight

29.1 kDa

References & Citations

"The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes." Streichert T., Ebrahimnejad A., Ganzer S., Flayeh R., Wagener C., Bruemmer J. Biochem. Biophys. Res. Commun. 289:191-197 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACADM (NM_001127328) Human Over-expression Lysate
LC426749 20 µg

ACADM (NM_001127328) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NUP107 activation kit by CRISPRa
GA111388 1 Kit

Human NUP107 activation kit by CRISPRa

Sign In for Pricing
View Details
ApaI, 600U
RE1124 600 U

ApaI, 600U

Sign In for Pricing
View Details
AATOM™ 390 amine
70208-AAT 1 mg

AATOM™ 390 amine

Sign In for Pricing
View Details
AA-dUTP [Aminoallyl dUTP sodium salt] *4 mM in TE Buffer (pH 7.5) * *CAS 936327-10-5*
17004-AAT 1 µmole

AA-dUTP [Aminoallyl dUTP sodium salt] *4 mM in TE Buffer (pH 7.5) * *CAS 936327-10-5*

Sign In for Pricing
View Details
RGP1 Human Gene Knockout Kit (CRISPR)
KN418325 1 Kit

RGP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details