Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Wnt-8b (Wnt8b)

Product Specifications

Product Name Alternative

Wnt8bProtein Wnt-8b

Abbreviation

Recombinant Mouse Wnt8b protein

Gene Name

Wnt8b

UniProt

Q9WUD6

Expression Region

22-350aa

Organism

Mus musculus (Mouse)

Target Sequence

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.

Molecular Weight

56.2 kDa

References & Citations

"Early embryonic lethality in Bmp5; Bmp7 double mutant mice suggests functional redundancy within the 60A subgroup." Solloway M.J., Robertson E.J. Development 126:1753-1768 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Artemin (GFRalpha3-RET Ligand) (MaxLight 650)
MBS6464151-01 0.1 mL

Artemin (GFRalpha3-RET Ligand) (MaxLight 650)

Sign In for Pricing
View Details
Artemin (GFRalpha3-RET Ligand) (MaxLight 650)
MBS6464151-02 5x 0.1 mL

Artemin (GFRalpha3-RET Ligand) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Ovine Fatty Acid Binding Protein 4 (FABP4), N-His
AP7F40-01 1 mg

Recombinant Ovine Fatty Acid Binding Protein 4 (FABP4), N-His

Sign In for Pricing
View Details
Recombinant Ovine Fatty Acid Binding Protein 4 (FABP4), N-His
AP7F40-02 10 µg

Recombinant Ovine Fatty Acid Binding Protein 4 (FABP4), N-His

Sign In for Pricing
View Details
Recombinant Ovine Fatty Acid Binding Protein 4 (FABP4), N-His
AP7F40-03 200 µg

Recombinant Ovine Fatty Acid Binding Protein 4 (FABP4), N-His

Sign In for Pricing
View Details
Recombinant Ovine Fatty Acid Binding Protein 4 (FABP4), N-His
AP7F40-04 5 mg

Recombinant Ovine Fatty Acid Binding Protein 4 (FABP4), N-His

Sign In for Pricing
View Details