Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C chemokine receptor type 4 (CXCR4), partial

Product Specifications

Product Name Alternative

FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor

Abbreviation

Recombinant Human CXCR4 protein, partial

Gene Name

CXCR4

UniProt

P61073

Expression Region

303-352aa

Organism

Homo sapiens (Human)

Target Sequence

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.

Molecular Weight

25.2 kDa

References & Citations

"A proposed bovine neuropeptide Y (NPY) receptor cDNA clone, or its human homologue, confers neither NPY binding sites nor NPY responsiveness on transfected cells." Jazin E.E., Yoo H., Blomqvist A.G., Yee F., Weng G., Walker M.W., Salon J., Larhammar D., Wahlestedt C.R. Regul. Pept. 47:247-258 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

K Cadherin Recombinant Antibody, PE Conjugated
bsm-61762R-PE 100 µL

K Cadherin Recombinant Antibody, PE Conjugated

Ask
View Details
Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)
MBS1093996-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)

Ask
View Details
Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)
MBS1093996-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)

Ask
View Details
Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)
MBS1093996-03 0.1 mg (E-Coli)

Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)

Ask
View Details
Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)
MBS1093996-04 0.1 mg (Yeast)

Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)

Ask
View Details
Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)
MBS1093996-05 0.02 mg (Baculovirus)

Recombinant Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog (aha-1)

Ask
View Details