Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atlantic salmon Vertebrate ancient opsin, partial

Product Specifications

Product Name Alternative

Vertebrate ancient opsin

Abbreviation

Recombinant Atlantic salmon Vertebrate ancient opsin protein, partial

UniProt

O13018

Expression Region

1-75aa

Organism

Salmo salar (Atlantic salmon)

Target Sequence

MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN

Tag

N-terminal 6xHis-B2M-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.5 kDa

References & Citations

"A novel and ancient vertebrate opsin." Soni B.G., Foster R.G. FEBS Lett. 406:279-283 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGFR-IN-7
HY-169627 1 Each

VEGFR-IN-7

Sign In for Pricing
View Details
53BP1 (TP53BP1) Rabbit Polyclonal Antibody
TA332891 100 µL

53BP1 (TP53BP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PACSIN2 (Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2, Syndapin-2, Syndapin-II)
327325-01 50 µL

PACSIN2 (Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2, Syndapin-2, Syndapin-II)

Sign In for Pricing
View Details
PACSIN2 (Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2, Syndapin-2, Syndapin-II)
327325-02 100 µL

PACSIN2 (Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2, Syndapin-2, Syndapin-II)

Sign In for Pricing
View Details
Glucose 6 phosphatase 2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-22837R-BF647 100 µL

Glucose 6 phosphatase 2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
MAGE-1 (MZ2 E, cancer/testis antigen 1.1, CT1.1, MAGE1A, MAGEA1, Melanoma antigen family A 1, Melanoma Associated antigen 1, Melanoma Associated antigen MZ2 E) (BSA & Azide Free) (MaxLight 750)
MBS6236709-01 0.1 mL

MAGE-1 (MZ2 E, cancer/testis antigen 1.1, CT1.1, MAGE1A, MAGEA1, Melanoma antigen family A 1, Melanoma Associated antigen 1, Melanoma Associated antigen MZ2 E) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details