Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Forkhead box protein M1 (FOxM1), partial

Product Specifications

Product Name Alternative

Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11

Abbreviation

Recombinant Human FOXM1 protein, partial

Gene Name

FOXM1

UniProt

Q08050

Expression Region

235-327aa

Organism

Homo sapiens (Human)

Target Sequence

ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.

Molecular Weight

31.2 kDa

References & Citations

"Hepatocyte nuclear factor 3/fork head homolog 11 is expressed in proliferating epithelial and mesenchymal cells of embryonic and adult tissues." Ye H., Kelly T.F., Samadani U., Lim L., Rubio S., Overdier D.G., Roebuck K.A., Costa R.H. Mol. Cell. Biol. 17:1626-1641 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Homoleucine hydrochloride 98+% (TLC)
237172-01 100 mg

D-Homoleucine hydrochloride 98+% (TLC)

Sign In for Pricing
View Details
D-Homoleucine hydrochloride 98+% (TLC)
237172-02 250 mg

D-Homoleucine hydrochloride 98+% (TLC)

Sign In for Pricing
View Details
D-Homoleucine hydrochloride 98+% (TLC)
237172-03 1 g

D-Homoleucine hydrochloride 98+% (TLC)

Sign In for Pricing
View Details
D-Homoleucine hydrochloride 98+% (TLC)
237172-04 5 g

D-Homoleucine hydrochloride 98+% (TLC)

Sign In for Pricing
View Details
IFI35 ORF Vector (Human) (pORF)
ORF021345 1.0 µg DNA

IFI35 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Fatty Acid Binding Protein 2, Intestinal (FABP2)
151756 200 µL

Fatty Acid Binding Protein 2, Intestinal (FABP2)

Sign In for Pricing
View Details