Recombinant Rat Beta-nerve growth factor (Ngf)
Product Specifications
Product Name Alternative
Ngf; Ngfb; Beta-nerve growth factor; Beta-NGF
Abbreviation
Recombinant Rat Ngf protein
Gene Name
Ngf
UniProt
P25427
Expression Region
122-241aa
Organism
Rattus norvegicus (Rat)
Target Sequence
SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
Tag
N-terminal 6xHis-tagged
Type
Developed Protein
Source
Yeast
Field of Research
Neuroscience
Relevance
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Molecular Weight
15.4 kDa
References & Citations
"Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary." Hallboeoek F., Ibanez C.F., Persson H. Neuron 6:845-858 (1991)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15101777 1 Vial
Lentiviral human GRAMD1A shRNA (UAS) - Lentiviral human GRAMD1A shRNA (UAS) (25)
Sign In for Pricing
View Details 
AZA0A8M9PH45-HRP 100 µg/Vial
Anti-Zebrafish CLOCKA Antibody Picoband® HRP Conjugated
Sign In for Pricing
View Details MBS2009225-01 0.01 mg
Recombinant Hypoxia Inducible Factor 2 Alpha (HIF2a)
Sign In for Pricing
View Details MBS2009225-02 0.05 mg
Recombinant Hypoxia Inducible Factor 2 Alpha (HIF2a)
Sign In for Pricing
View Details MBS2009225-03 0.1 mg
Recombinant Hypoxia Inducible Factor 2 Alpha (HIF2a)
Sign In for Pricing
View Details