Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2)

Product Specifications

Product Name Alternative

Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog B

Abbreviation

Recombinant Mouse Nkx3-2 protein

Gene Name

Nkx3-2

UniProt

P97503

Expression Region

1-333aa

Organism

Mus musculus (Mouse)

Target Sequence

MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.

Molecular Weight

35.2 kDa

References & Citations

"Bapx1 regulates patterning in the middle ear: altered regulatory role in the transition from the proximal jaw during vertebrate evolution." Tucker A.S., Watson R.P., Lettice L.A., Yamada G., Hill R.E. Development 131:1235-1245 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC Linked Monoclonal Antibody to Interleukin 7 (IL7)
MBS2130707-01 0.1 mL

APC Linked Monoclonal Antibody to Interleukin 7 (IL7)

Ask
View Details
APC Linked Monoclonal Antibody to Interleukin 7 (IL7)
MBS2130707-02 0.2 mL

APC Linked Monoclonal Antibody to Interleukin 7 (IL7)

Ask
View Details
APC Linked Monoclonal Antibody to Interleukin 7 (IL7)
MBS2130707-03 0.5 mL

APC Linked Monoclonal Antibody to Interleukin 7 (IL7)

Ask
View Details
APC Linked Monoclonal Antibody to Interleukin 7 (IL7)
MBS2130707-04 1 mL

APC Linked Monoclonal Antibody to Interleukin 7 (IL7)

Ask
View Details
APC Linked Monoclonal Antibody to Interleukin 7 (IL7)
MBS2130707-05 5 mL

APC Linked Monoclonal Antibody to Interleukin 7 (IL7)

Ask
View Details
APC Linked Monoclonal Antibody to Interleukin 7 (IL7)
MBS2130707-06 5x 5 mL

APC Linked Monoclonal Antibody to Interleukin 7 (IL7)

Ask
View Details