Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A14 (S100A14)

Product Specifications

Product Name Alternative

S100 calcium-binding protein A14

Abbreviation

Recombinant Human S100A14 protein

Gene Name

S100A14

UniProt

Q9HCY8

Expression Region

1-104aa

Organism

Homo sapiens (Human)

Target Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.

Molecular Weight

38.7 kDa

References & Citations

"S100A14 stimulates cell proliferation and induces cell apoptosis at different concentrations via receptor for advanced glycation end products (RAGE) ." Jin Q., Chen H., Luo A., Ding F., Liu Z. PLoS ONE 6:E19375-E19375 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant BOB1 Antibody
RC-16907-01 50 μL

Recombinant BOB1 Antibody

Sign In for Pricing
View Details
Recombinant BOB1 Antibody
RC-16907-02 100 µL

Recombinant BOB1 Antibody

Sign In for Pricing
View Details
Recombinant BOB1 Antibody
RC-16907-03 1 mL

Recombinant BOB1 Antibody

Sign In for Pricing
View Details
NARG2 (ICE2) Human Gene Knockout Kit (CRISPR)
KN418525 1 Kit

NARG2 (ICE2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAPRIN2 Rabbit Polyclonal Antibody
TA362267 100 µL

CAPRIN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB (LN-3), 0.2mg/mL
BNUB0057-500 1x 500 µL

HLA-DRB (LN-3), 0.2mg/mL

Sign In for Pricing
View Details