Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-18 (RAB18)

Product Specifications

Product Name Alternative

AA959686; RAB18; RAB18 small GTPase; RAB18; member RAS oncogene family; RAB18_HUMAN; RAB18LI1; Ras related protein Rab 18; Ras-asssociated protein RAB18; Ras-related protein Rab-18; RP11-148B2.1; WARBM3

Abbreviation

Recombinant Human RAB18 protein

Gene Name

RAB18

UniProt

Q9NP72

Expression Region

1-206aa

Organism

Homo sapiens (Human)

Target Sequence

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.

Molecular Weight

49.7 kDa

References & Citations

"In silico cloning of the human Rab18 gene." Chikri M.M., Boutin M.P., Vaxillaire M.M., Froguel M.P. Submitted (APR-2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Peripheral nerve
CS512037 5x 5 µm

Frozen Tissue Sections, Peripheral nerve

Sign In for Pricing
View Details
GRAMD1B Human Gene Knockout Kit (CRISPR)
KN219269BN 1 Kit

GRAMD1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF384 (NM_001039916) Human Over-expression Lysate
LC421852 20 µg

ZNF384 (NM_001039916) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details