Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Molybdopterin synthase catalytic subunit (MOCS2)

Product Specifications

Product Name Alternative

MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B

Abbreviation

Recombinant Human MOCS2 protein

Gene Name

MOCS2

UniProt

O96007

Expression Region

1-188aa

Organism

Homo sapiens (Human)

Target Sequence

MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.

Molecular Weight

47.9 kDa

References & Citations

"Human molybdopterin synthase gene: identification of a bicistronic transcript with overlapping reading frames." Stallmeyer B., Drugeon G., Reiss J., Haenni A.L., Mendel R.R. Am. J. Hum. Genet. 64:698-705 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-VEGF Receptor 3/FLT4 Antibody Picoband®
A01276-2 100 μg/Vial

Anti-VEGF Receptor 3/FLT4 Antibody Picoband®

Ask
View Details
Sheep Wingless Type MMTV Integration Site Family, Member 5A ELISA Kit
MBS087325-01 48 Well

Sheep Wingless Type MMTV Integration Site Family, Member 5A ELISA Kit

Ask
View Details
Sheep Wingless Type MMTV Integration Site Family, Member 5A ELISA Kit
MBS087325-02 96 Well

Sheep Wingless Type MMTV Integration Site Family, Member 5A ELISA Kit

Ask
View Details
Sheep Wingless Type MMTV Integration Site Family, Member 5A ELISA Kit
MBS087325-03 5x 96 Well

Sheep Wingless Type MMTV Integration Site Family, Member 5A ELISA Kit

Ask
View Details
Sheep Wingless Type MMTV Integration Site Family, Member 5A ELISA Kit
MBS087325-04 10x 96 Well

Sheep Wingless Type MMTV Integration Site Family, Member 5A ELISA Kit

Ask
View Details
HSPB3, 1-150aa, Human, His tag, E Coli (Denatured)
MBS204611-01 0.02 mg

HSPB3, 1-150aa, Human, His tag, E Coli (Denatured)

Ask
View Details