Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-conjugating enzyme E2 S (UBE2S)

Product Specifications

Product Name Alternative

E2 ubiquitin-conjugating enzyme S E2-EPF Ubiquitin carrier protein S Ubiquitin-conjugating enzyme E2-24KDA Ubiquitin-conjugating enzyme E2-EPF5 Ubiquitin-protein ligase S

Abbreviation

Recombinant Human UBE2S protein

Gene Name

UBE2S

UniProt

Q16763

Expression Region

1-222aa

Organism

Homo sapiens (Human)

Target Sequence

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes 'Lys-11'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit. Also acts by elongating ubiquitin chains initiated by the E2 enzyme UBE2D1/UBCH5 in vitro; it is however unclear whether UBE2D1/UBCH5 acts as an E2 enzyme for the APC/C in vivo. Also involved in ubiquitination and subsequent degradation of VHL, resulting in an accumulation of HIF1A. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, except 'Lys-48'-linked polyubiquitination.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins

Molecular Weight

50.8 kDa

References & Citations

"E2-EPF UCP targets pVHL for degradation and associates with tumor growth and metastasis." Jung C.R., Hwang K.S., Yoo J., Cho W.K., Kim J.M., Kim W.H., Im D.S. Nat. Med. 12:809-816 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS803597 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
IL23R Rabbit Polyclonal Antibody
HA500387 100 µL

IL23R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCC112 (PDS5A) (C-term) Rabbit Polyclonal Antibody
AP53248PU-N 400 µL

SCC112 (PDS5A) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD45 Human qPCR Primer Pair (NM_198493)
HP219352 200 Reactions

ANKRD45 Human qPCR Primer Pair (NM_198493)

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF594 conjugate, 0.1mg/mL
BNC941482-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3,4-Dihydro-6-nitro-2(1H)-quinolinone
TRC-D449190-2G 2 g

3,4-Dihydro-6-nitro-2(1H)-quinolinone

Sign In for Pricing
View Details