Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-related protein 2/3 complex subunit 5-like protein (ARPC5L)

Product Specifications

Product Name Alternative

Arp2/3 complex 16KDA subunit

Abbreviation

Recombinant Human ARPC5 protein

Gene Name

ARPC5

UniProt

O15511

Expression Region

1-154aa

Organism

Homo sapiens (Human)

Target Sequence

MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Molecular Weight

43.6 kDa

References & Citations

"The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly." Welch M.D., Depace A.H., Verma S., Iwamatsu A., Mitchison T.J. J. Cell Biol. 138:375-384 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PITPNB Mouse Monoclonal Antibody [Clone ID: OTI6H10]
CF809305 100 µg

PITPNB Mouse Monoclonal Antibody [Clone ID: OTI6H10]

Sign In for Pricing
View Details
HADHB (C-term) Rabbit Polyclonal Antibody
AP51996PU-N 400 µL

HADHB (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(3R,S)-Oxidosqualene (>90%)
TRC-O846815-5MG 5 mg

(3R,S)-Oxidosqualene (>90%)

Sign In for Pricing
View Details
Recombinant Human LYG2 Protein (His Tag)
PKSH032723-01 10 µg

Recombinant Human LYG2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LYG2 Protein (His Tag)
PKSH032723-02 50 µg

Recombinant Human LYG2 Protein (His Tag)

Sign In for Pricing
View Details
Cholera Toxin Subunit B (Recombinant)
29130-1mg 1 mg

Cholera Toxin Subunit B (Recombinant)

Sign In for Pricing
View Details