Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myomegalin (PDE4DIP)

Product Specifications

Product Name Alternative

Cardiomyopathy-associated protein 2 Phosphodiesterase 4D-interacting protein

Abbreviation

Recombinant Human PDE4DIP protein

Gene Name

PDE4DIP

UniProt

Q5VU43

Expression Region

1-310aa

Organism

Homo sapiens (Human)

Target Sequence

MKGTDSGSCCRRRCDFGCCCRASRRAHYTPYRSGDATRTPQSPRQTPSRERRRPEPAGSWAAAAEEEEAAAAATPWMRDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May function as an anchor sequestering components of the cAMP-dependent pathway to Golgi and/or centrosomes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Functions as an anchor sequestering components of the cAMP-dependent pathway to Golgi and/or centrosomes (By similarity) . Forms a complex with AKAP9

Molecular Weight

63.1 kDa

References & Citations

"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 8

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)
MBS1311110-01 0.02 mg (E-Coli)

Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)
MBS1311110-02 0.1 mg (E-Coli)

Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)
MBS1311110-03 0.02 mg (Yeast)

Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)
MBS1311110-04 0.1 mg (Yeast)

Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)
MBS1311110-05 0.02 mg (Baculovirus)

Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)
MBS1311110-06 0.02 mg (Mammalian-Cell)

Recombinant Rhodoferax ferrireducens Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details