Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cysteine-rich protein 1 (CRIP1), partial

Product Specifications

Product Name Alternative

Cysteine-rich heart protein

Abbreviation

Recombinant Human CRIP1 protein, partial

Gene Name

CRIP1

UniProt

P50238

Expression Region

2-77aa

Organism

Homo sapiens (Human)

Target Sequence

PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.

Molecular Weight

35.4 kDa

References & Citations

"Human cysteine-rich intestinal protein: cDNA cloning and expression of recombinant protein and identification in human peripheral blood mononuclear cells." Khoo C., Blanchard R.K., Sullivan V.K., Cousins R.J. Protein Expr. Purif. 9:379-387 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD20A5P (NM_001029999) Human Over-expression Lysate
LC422279 20 µg

ANKRD20A5P (NM_001029999) Human Over-expression Lysate

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF640R conjugate, 0.1mg/mL
BNC403527-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APEX2 Human Gene Knockout Kit (CRISPR)
KN200320 1 Kit

APEX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Versican Core Protein Antibody (Biotin)
KB-8215-01 50 μL

Versican Core Protein Antibody (Biotin)

Sign In for Pricing
View Details
Versican Core Protein Antibody (Biotin)
KB-8215-02 100 µL

Versican Core Protein Antibody (Biotin)

Sign In for Pricing
View Details
Versican Core Protein Antibody (Biotin)
KB-8215-03 1 mL

Versican Core Protein Antibody (Biotin)

Sign In for Pricing
View Details