Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calmodulin-like protein 3 (CALML3)

Product Specifications

Product Name Alternative

CaM-like protein

Abbreviation

Recombinant Human CALML3 protein

Gene Name

CALML3

UniProt

P27482

Expression Region

1-149aa

Organism

Homo sapiens (Human)

Target Sequence

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.

Molecular Weight

43.9 kDa

References & Citations

"Down-regulation of a calmodulin-related gene during transformation of human mammary epithelial cells." Yaswen P., Smoll A., Peehl D.M., Trask D.K., Sager R., Stampfer M.R. Proc. Natl. Acad. Sci. U.S.A. 87:7360-7364 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl2-L-13 Recombinant Rabbit monoclonal Antibody
HA751616 100 µL

Bcl2-L-13 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Interleukin-36 alpha/IL-36 alpha
PKSH033873-01 20 µg

Recombinant Human Interleukin-36 alpha/IL-36 alpha

Sign In for Pricing
View Details
Recombinant Human Interleukin-36 alpha/IL-36 alpha
PKSH033873-02 100 µg

Recombinant Human Interleukin-36 alpha/IL-36 alpha

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF647 conjugate, 0.1mg/mL
BNC472318-100 1x 100 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human TWF1/Twinfilin-1 Protein (His & GST Tag)
PKSH030992 100 µg

Recombinant Human TWF1/Twinfilin-1 Protein (His & GST Tag)

Sign In for Pricing
View Details
Recombinant Human INHBA Protein (His Tag)
PDEH101130-01 20 µg

Recombinant Human INHBA Protein (His Tag)

Sign In for Pricing
View Details