Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tubulin polymerization-promoting protein (TPPP)

Product Specifications

Product Name Alternative

25KDA brain-specific protein TPPP/p25 p24 p25-alpha

Abbreviation

Recombinant Human TPPP protein

Gene Name

TPPP

UniProt

O94811

Expression Region

1-219aa

Organism

Homo sapiens (Human)

Target Sequence

MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.

Molecular Weight

50.7 kDa

References & Citations

"p25alpha Stimulates alpha-synuclein aggregation and is co-localized with aggregated alpha-synuclein in alpha-synucleinopathies." Lindersson E., Lundvig D., Petersen C., Madsen P., Nyengaard J.R., Hoejrup P., Moos T., Otzen D., Gai W.-P., Blumbergs P.C., Jensen P.H. J. Biol. Chem. 280:5703-5715 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pfn2 (NM_019410) Mouse Tagged ORF Clone
MG200894 10 µg

Pfn2 (NM_019410) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IGFL2 (NM_001135113) Human Recombinant Protein
TP325054 20 µg

IGFL2 (NM_001135113) Human Recombinant Protein

Sign In for Pricing
View Details
MT1F (NM_005949) Human Recombinant Protein
TP305931L 1 mg

MT1F (NM_005949) Human Recombinant Protein

Sign In for Pricing
View Details
RAB10 Recombinant Rabbit monoclonal Antibody
HA750864 100 µL

RAB10 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808177 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Δ23-FK-506(>90%)
TRC-F370015-25MG 25 mg

Δ23-FK-506(>90%)

Sign In for Pricing
View Details