Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SUMO-activating enzyme subunit 1 (SAE1)

Product Specifications

Product Name Alternative

Ubiquitin-like 1-activating enzyme E1A

Abbreviation

Recombinant Human SAE1 protein

Gene Name

SAE1

UniProt

Q9UBE0

Expression Region

1-346aa

Organism

Homo sapiens (Human)

Target Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.

Molecular Weight

65.4 kDa

References & Citations

"In vitro SUMO-1 modification requires two enzymatic steps, E1 and E2." Okuma T., Honda R., Ichikawa G., Tsumagari N., Yasuda H. Biochem. Biophys. Res. Commun. 254:693-698 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCK siRNA (h)
sc-35458 10 µM

GCK siRNA (h)

Sign In for Pricing
View Details
Carboxypeptidase M (CPM) (NM_198320) Human Over-expression Lysate
E45H16163-2 20 µg

Carboxypeptidase M (CPM) (NM_198320) Human Over-expression Lysate

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
MBS2118708-01 0.1 mL

PE-Linked Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
MBS2118708-02 0.2 mL

PE-Linked Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
MBS2118708-03 0.5 mL

PE-Linked Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
MBS2118708-04 1 mL

PE-Linked Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details