Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rap-2b (RAP2B)

Product Specifications

Product Name Alternative

MGC20484; RAP 2B; RAP2A; Rap2b; RAP2B member of RAS oncogene family; RAP2B_HUMAN; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B; Ras related protein RAP2B; Ras-related protein Rap-2b; Small GTP binding protein

Abbreviation

Recombinant Human RAP2B protein

Gene Name

RAP2B

UniProt

P61225

Expression Region

1-183aa

Organism

Homo sapiens (Human)

Target Sequence

MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.

Molecular Weight

47.2 kDa

References & Citations

"RAP2B: a RAS-related GTP-binding protein from platelets." Ohmstede C.A., Farrell F.X., Reep B.R., Clemetson K.J., Lapetina E.G. Proc. Natl. Acad. Sci. U.S.A. 87:6527-6531 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C2orf28 3'UTR Lenti-reporter-Luc Vector
14398081 1.0 μg

C2orf28 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Lfc Polyclonal Antibody
E44H01576 100ul

Lfc Polyclonal Antibody

Ask
View Details
ITGB1BP1, ID (ITGB1BP1, ICAP1, Integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1) (MaxLight 550)
MBS6311253-01 0.1 mL

ITGB1BP1, ID (ITGB1BP1, ICAP1, Integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1) (MaxLight 550)

Ask
View Details
ITGB1BP1, ID (ITGB1BP1, ICAP1, Integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1) (MaxLight 550)
MBS6311253-02 5x 0.1 mL

ITGB1BP1, ID (ITGB1BP1, ICAP1, Integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1) (MaxLight 550)

Ask
View Details