Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphomannomutase 2 (PMM2)

Product Specifications

Product Name Alternative

AI585868; BOS_22465; C86848; CDG 1; CDG1; CDG1a; CDGS; MGC127449; Phosphomannomutase 2; PMM 2; Pmm2; PMM2_HUMAN

Abbreviation

Recombinant Human PMM2 protein

Gene Name

PMM2

UniProt

O15305

Expression Region

1-246aa

Organism

Homo sapiens (Human)

Target Sequence

MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

Molecular Weight

55 kDa

References & Citations

"Mutations in PMM2, a phosphomannomutase gene on chromosome 16p13, in carbohydrate-deficient glycoprotein type I syndrome (Jaeken syndrome) ." Matthijs G., Schollen E., Pardon E., Veiga-Da-Cunha M., Jaeken J., Cassiman J.-J., van Schaftingen E. Nat. Genet. 16:88-92 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2043919-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2043919-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2043919-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2043919-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2043919-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2043919-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details