Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase subunitd, mitochondrial (ATP5H)

Product Specifications

Product Name Alternative

ATP synthase D chain mitochondrial; ATP synthase H+ transporting mitochondrial F1F0 subunit; ATP synthase H+ transporting mitochondrial F1F0 subunit d; ATP synthase subunit d; ATP synthase subunit d; mitochondrial; ATP synthase; H+ transporting; mitochondrial F0 complex; subunit d; ATP5H; ATP5H_HUMAN; ATP5JD; ATPase subunit d; ATPQ; mitochondrial; My032 protein

Abbreviation

Recombinant Human ATP5H protein

Gene Name

ATP5H

UniProt

O75947

Expression Region

1-161aa

Organism

Homo sapiens (Human)

Target Sequence

AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core, and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha (3) beta (3) subcomplex and subunit a/ATP6 static relative to the rotary elements.

Molecular Weight

45.4 kDa

References & Citations

"Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human E2F7 activation kit by CRISPRa
GA115499 1 Kit

Human E2F7 activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin-XX Tyramide
#92176 1x 500 µg

Biotin-XX Tyramide

Sign In for Pricing
View Details
Dll4 Mouse Gene Knockout Kit (CRISPR)
KN304622BN 1 Kit

Dll4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Txnip Mouse Gene Knockout Kit (CRISPR)
KN318517LP 1 Kit

Txnip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASTE1 (NM_001288950) Human Tagged ORF Clone
RG239363 10 µg

ASTE1 (NM_001288950) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant FGF1 Antibody
RC-4946-01 50 μL

Recombinant FGF1 Antibody

Sign In for Pricing
View Details