Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19)

Product Specifications

Product Name Alternative

DnaJ homolog subfamily C member 19

Abbreviation

Recombinant Human DNAJC19 protein

Gene Name

DNAJC19

UniProt

Q96DA6

Expression Region

1-116aa

Organism

Homo sapiens (Human)

Target Sequence

MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity) .

Molecular Weight

39.5 kDa

References & Citations

"Characterization of the human heart mitochondrial proteome." Taylor S.W., Fahy E., Zhang B., Glenn G.M., Warnock D.E., Wiley S., Murphy A.N., Gaucher S.P., Capaldi R.A., Gibson B.W., Ghosh S.S. Nat. Biotechnol. 21:281-286 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B14 Protein Vector (Rat) (pPM-C-HA)
23935026 500 ng

HSD17B14 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CCL16 Human Pre-designed siRNA Set A
HY-RS02085 1 Set

CCL16 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse Stab1 shRNA (UAS) - Lentiviral mouse Stab1 shRNA (UAS) (25)
GTR15189857 1 Vial

Lentiviral mouse Stab1 shRNA (UAS) - Lentiviral mouse Stab1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal STEP Antibody [DyLight 755]
NBP2-81893IR 0.1 mL

Rabbit Polyclonal STEP Antibody [DyLight 755]

Sign In for Pricing
View Details
OR5L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
35457111 3x 1.0 µg

OR5L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MAPT Protein (Native, Human)
P526685 100 µg

MAPT Protein (Native, Human)

Sign In for Pricing
View Details