Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cysteine dioxygenase type 1 (CDO1)

Product Specifications

Product Name Alternative

Cysteine dioxygenase type I

Abbreviation

Recombinant Human CDO1 protein

Gene Name

CDO1

UniProt

Q16878

Expression Region

1-200aa

Organism

Homo sapiens (Human)

Target Sequence

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.

Molecular Weight

50 kDa

References & Citations

"Human cysteine dioxygenase type I: primary structure derived from base sequencing of cDNA." McCann K.P., Akbari M.T., Williams A.C., Ramsden D.B. Biochim. Biophys. Acta 1209:107-110 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human CYPA Matched Antibody Pair Set [ABP-S-03226]
ABP-S-03226 5 Plates

Human CYPA Matched Antibody Pair Set [ABP-S-03226]

Ask
View Details
F8 Recombinant Rabbit mAb
E43S49234 100 µL

F8 Recombinant Rabbit mAb

Ask
View Details
Lentiviral human MED19 sgRNA gene knockout kit - Lentiviral human MED19 sgRNA gene knockout kit (25)
GTR15358263 1 Vial

Lentiviral human MED19 sgRNA gene knockout kit - Lentiviral human MED19 sgRNA gene knockout kit (25)

Ask
View Details
NR4A1, phosphorylated (Ser351) (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (APC)
N0018-01G-APC 200 µL

NR4A1, phosphorylated (Ser351) (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (APC)

Ask
View Details
Rpn1 3'UTR Lenti-reporter-Luc Vector
41994084 1.0 µg

Rpn1 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Monkey Claudin-6 (CLDN6) ELISA Kit
MBS7217468-01 48 Well

Monkey Claudin-6 (CLDN6) ELISA Kit

Ask
View Details