Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Centrin-3 (CETN3)

Product Specifications

Product Name Alternative

CDC31 homolog; CEN 3; CEN3; Centrin EF hand protein 3; Centrin-3; Centrin3; CETN 3; Cetn3; CETN3_HUMAN; EF hand superfamily member; MGC12502; MGC138245

Abbreviation

Recombinant Human CETN3 protein

Gene Name

CETN3

UniProt

O15182

Expression Region

1-167aa

Organism

Homo sapiens (Human)

Target Sequence

MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Plays a fundamental role in microtubule-organizing center structure and function. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket) . TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a fundamental role in microtubule-organizing center structure and function.; FUNCTION

Molecular Weight

46.5 kDa

References & Citations

"Identification of a new mammalian centrin gene, more closely related to Saccharomyces cerevisiae CDC31 gene." Middendorp S., Paoletti A., Schiebel E., Bornens M. Proc. Natl. Acad. Sci. U.S.A. 94:9141-9146 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK13 Antibody
orb1334095 100 µg

MAPK13 Antibody

Sign In for Pricing
View Details
Rabbit Anti-Rat Glutathione S Transferase Alpha 5 (GSTa5) Polyclonal Antibody
VD2N945 1 Each

Rabbit Anti-Rat Glutathione S Transferase Alpha 5 (GSTa5) Polyclonal Antibody

Sign In for Pricing
View Details
SPRR1B Antibody, Biotin conjugated
CSB-PA022611LD01HU-01 50 µg

SPRR1B Antibody, Biotin conjugated

Sign In for Pricing
View Details
SPRR1B Antibody, Biotin conjugated
CSB-PA022611LD01HU-02 100 µg

SPRR1B Antibody, Biotin conjugated

Sign In for Pricing
View Details
AMAP-1 (G-9) : m-IgGκ BP-HRP Bundle
sc-523526 1 Kit

AMAP-1 (G-9) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Low Density Lipoprotein Receptor Adapter Protein 1 (LDLRAP1) Antibody
abx033819-01 80 µL

Low Density Lipoprotein Receptor Adapter Protein 1 (LDLRAP1) Antibody

Sign In for Pricing
View Details