Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B9 domain-containing protein 2 (B9D2)

Product Specifications

Product Name Alternative

MKS1-related protein 2

Abbreviation

Recombinant Human B9D2 protein

Gene Name

B9D2

UniProt

Q9BPU9

Expression Region

1-175aa

Organism

Homo sapiens (Human)

Target Sequence

MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Molecular Weight

46.3 kDa

References & Citations

"Functional interactions between the ciliopathy-associated Meckel syndrome 1 (MKS1) protein and two novel MKS1-related (MKSR) proteins." Bialas N.J., Inglis P.N., Li C., Robinson J.F., Parker J.D., Healey M.P., Davis E.E., Inglis C.D., Toivonen T., Cottell D.C., Blacque O.E., Quarmby L.M., Katsanis N., Leroux M.R. J. Cell Sci. 122:611-624 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDA11 Antibody
MBS9520180-01 0.04 mL

HDA11 Antibody

Sign In for Pricing
View Details
HDA11 Antibody
MBS9520180-02 0.1 mL

HDA11 Antibody

Sign In for Pricing
View Details
HDA11 Antibody
MBS9520180-03 0.2 mL

HDA11 Antibody

Sign In for Pricing
View Details
HDA11 Antibody
MBS9520180-04 5x 0.2 mL

HDA11 Antibody

Sign In for Pricing
View Details
Recombinant Glucagon Like Peptide 1 (GLP1)
MBS2140198-01 0.01 mg

Recombinant Glucagon Like Peptide 1 (GLP1)

Sign In for Pricing
View Details
Recombinant Glucagon Like Peptide 1 (GLP1)
MBS2140198-02 0.05 mg

Recombinant Glucagon Like Peptide 1 (GLP1)

Sign In for Pricing
View Details