Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Guanine nucleotide-binding protein subunit beta-like protein 1 (GNB1L)

Product Specifications

Product Name Alternative

DGCRK3 WD repeat-containing protein 14 WD40 repeat-containing protein deleted in VCFS

Abbreviation

Recombinant Human GNB1L protein

Gene Name

GNB1L

UniProt

Q9BYB4

Expression Region

1-327aa

Organism

Homo sapiens (Human)

Target Sequence

MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

62.6 kDa

References & Citations

"GNB1L, a gene deleted in the critical region for DiGeorge syndrome on 22q11, encodes a G-protein beta-subunit-like polypeptide." Gong L., Liu M., Jen J., Yeh E.T.H. Biochim. Biophys. Acta 1494:185-188 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 1 Lentiviral Activation Particles (m2)
sc-419439-LAC-2 200 µL

Calpain 1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Monoclonal Smad4 Antibody (277)
NBP2-61587 100 µL

Rabbit Monoclonal Smad4 Antibody (277)

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)
KN218572RB 1 Kit

AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
T2-cadherin siRNA (m)
sc-153998 10 µM

T2-cadherin siRNA (m)

Sign In for Pricing
View Details
GPBAR1 siRNA (Rat)
MBS8218372-01 15 nmol

GPBAR1 siRNA (Rat)

Sign In for Pricing
View Details
GPBAR1 siRNA (Rat)
MBS8218372-02 30 nmol

GPBAR1 siRNA (Rat)

Sign In for Pricing
View Details