Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphoserine phosphatase (PSPH)

Product Specifications

Product Name Alternative

L-3-phosphoserine phosphatase O-phosphoserine phosphohydrolase

Abbreviation

Recombinant Human PSPH protein

Gene Name

PSPH

UniProt

P78330

Expression Region

1-225aa

Organism

Homo sapiens (Human)

Target Sequence

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates.

Molecular Weight

52 kDa

References & Citations

"Human L-3-phosphoserine phosphatase: sequence, expression and evidence for a phosphoenzyme intermediate." Collet J.-F., Gerin I., Rider M.H., Veiga-Da-Cunha M., Van Schaftingen E. FEBS Lett. 408:281-284 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF75A Human Gene Knockout Kit (CRISPR)
KN420339 1 Kit

ZNF75A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Phospholipase A2 Activator Protein Antibody
RC-16250-01 50 μL

Recombinant Phospholipase A2 Activator Protein Antibody

Sign In for Pricing
View Details
Recombinant Phospholipase A2 Activator Protein Antibody
RC-16250-02 100 µL

Recombinant Phospholipase A2 Activator Protein Antibody

Sign In for Pricing
View Details
Recombinant Phospholipase A2 Activator Protein Antibody
RC-16250-03 1 mL

Recombinant Phospholipase A2 Activator Protein Antibody

Sign In for Pricing
View Details
Dihydroformononetin
TRC-D453338-5MG 5 mg

Dihydroformononetin

Sign In for Pricing
View Details
PINX1 Human Gene Knockout Kit (CRISPR)
KN401903 1 Kit

PINX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details